PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017789P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Nin-like
Protein Properties Length: 414aa    MW: 45291.1 Da    PI: 5.8481
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017789P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK941e-291667152
          RWP-RK  1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                    aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI RWP+Rki+++
  MELO3C017789P1 16 AEKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGILRWPSRKINKV 67
                    589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.824687IPR003035RWP-RK domain
PfamPF020423.1E-261967IPR003035RWP-RK domain
SuperFamilySSF542773.01E-23306398No hitNo description
Gene3DG3DSA:3.10.20.2403.6E-24310392No hitNo description
SMARTSM006665.2E-22313395IPR000270PB1 domain
PROSITE profilePS5174521.372313395IPR000270PB1 domain
PfamPF005641.4E-17316394IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MTNGSRRQGE KKRSTAEKNV SLSVLQQYFS GSLKDAAKSI GVCPTTLKRI CRQHGILRWP  60
SRKINKVNRS LRKIQTVLDS VKGVEGGLKF DPTTGGLMAA GSLIPEFNGQ NNLLFSDNNP  120
SIRNLEPLLQ DVSSVPPVSF NGQNSAMKLE IEDSFVTMSR RISSRDILIP EKEPNVCQLD  180
CSEGSKSTGL DAASCQLADL DMMGWEVAGN ATGSIIAKKG NRLDFVENDL RSSDADCQFM  240
AKSSCSFAAA DEMGTVMEGT DGINEHYQPT TSSMTDSSNG SGLLIHGSSS SCQSVEERKH  300
LQEKISCVDS DSKIIVKASY KDDTVRFKFD PSLGYLQLYE EVGKRFKLNQ GTFQLKYLDD  360
EKEWVMLVSN SDLQECLEVM DEIGTRNVKF LVRDITSAVG SSSSSSCFLP RVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818740.0LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008454098.10.0PREDICTED: protein NLP9
TrEMBLA0A0A0KTS60.0A0A0A0KTS6_CUCSA; Uncharacterized protein
STRINGPOPTR_0017s04980.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.22e-52Nin-like family protein